PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013613959.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 828aa    MW: 93890.5 Da    PI: 5.0705
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013613959.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.71.1e-07441485246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g+WT+eE+  l   +++    +W  Ia  +g++Rt+ qc  r+q 
   XP_013613959.1 441 GPWTAEEENNLRLIIQEKEFTDWLDIAVSLGTNRTPFQCLARYQR 485
                      89*****************************************96 PP

2Myb_DNA-binding45.91.3e-14493539148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      r+ WT+eEd++l  av+++G ++W t+a+ +  gR + qc +rw k l
   XP_013613959.1 493 RKEWTAEEDDQLRAAVELYGEKDWQTVANALE-GRAGTQCSNRWKKTL 539
                      789*****************************.***********9975 PP

3Myb_DNA-binding48.91.6e-15547591247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g+++ eE+++l+ av+++G  +W++Iar ++ gRt  qc+++w + 
   XP_013613959.1 547 GKFSSEEEKRLKVAVTLFGAQNWHKIARFVP-GRTSTQCREKWANC 591
                      79*****************************.***********885 PP

4Myb_DNA-binding53.65.3e-17599643247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g+W++eEd +l +a +++  g+W++Ia++++ +Rt++qc+ rw ++
   XP_013613959.1 599 GKWSKEEDAKLREAMAEHEIGNWSKIASHVP-RRTDNQCRRRWMQL 643
                      89*****************************.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.075338430IPR017877Myb-like domain
SMARTSM007170.12342436IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.9E-9345361IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.9E-9407446IPR009057Homeodomain-like
SuperFamilySSF466896.64E-13416484IPR009057Homeodomain-like
PROSITE profilePS500908.269435487IPR017877Myb-like domain
SMARTSM007173.0E-7439489IPR001005SANT/Myb domain
PfamPF002493.6E-7441485IPR001005SANT/Myb domain
CDDcd001676.71E-5442487No hitNo description
Gene3DG3DSA:1.10.10.601.8E-12447497IPR009057Homeodomain-like
SuperFamilySSF466892.3E-19472542IPR009057Homeodomain-like
PROSITE profilePS5129421.822488543IPR017930Myb domain
SMARTSM007176.1E-14492541IPR001005SANT/Myb domain
PfamPF002491.6E-12493538IPR001005SANT/Myb domain
CDDcd001673.59E-11495539No hitNo description
Gene3DG3DSA:1.10.10.602.9E-16498542IPR009057Homeodomain-like
PROSITE profilePS5129412.618544592IPR017930Myb domain
SMARTSM007174.0E-12545594IPR001005SANT/Myb domain
PfamPF002493.2E-13547591IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-17547596IPR009057Homeodomain-like
CDDcd001671.87E-10548590No hitNo description
SuperFamilySSF466895.39E-26572647IPR009057Homeodomain-like
PROSITE profilePS5129425.519593648IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.5E-21597643IPR009057Homeodomain-like
SMARTSM007174.5E-15597646IPR001005SANT/Myb domain
PfamPF002494.7E-16599643IPR001005SANT/Myb domain
CDDcd001672.05E-14600643No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 828 aa     Download sequence    Send to blast
MNRGALYESE DDDDEEEDDD IGEDLEDLRR ACIVPESNSD DVIAKSGEGG GGGGGGEIPS  60
DSENEDDFEM LRNLKSQLAS STGPPVGLPL PSDSESDDDF ELLRSLKSQL ALSMDARLPP  120
MSLSDDDDED DDSFETLRAI RRRLSAYANL DPDGAFMNDS LGKKKQVHAS DNEPSREILS  180
RSNTCESFPD QGGKVVTLPD SIQAGVSVDL HENNATAPLD QSSSFPEAAQ AFVEAIRRNR  240
AYQKFLRKKL TEIEAKIEQN EKHQKNVKIV VDFQASCKRI TKQTLSQGRD PRLQLISTPK  300
CGPRDSSEDN DKKISPLTFG PPENSRVENY RMAVKNYPVS VNRRSWSTEE NENLAKGLKQ  360
QLQETLLNEA IERSSDLEGS TDDIDAINES IKNLEITPEM IRQFLPKVNW DQLASMYFKD  420
RSAAECEARW ISSEDPLINH GPWTAEEENN LRLIIQEKEF TDWLDIAVSL GTNRTPFQCL  480
ARYQRSLNAD ILRKEWTAEE DDQLRAAVEL YGEKDWQTVA NALEGRAGTQ CSNRWKKTLH  540
PTRTRVGKFS SEEEKRLKVA VTLFGAQNWH KIARFVPGRT STQCREKWAN CLDPNVNHGK  600
WSKEEDAKLR EAMAEHEIGN WSKIASHVPR RTDNQCRRRW MQLYPHQVPL LQEATRLRKE  660
AIVGNFVDRE SQRPALLECK FLALPEIPLE PEPEIVVVKK KRKARPKKAD AECESEESSA  720
AKERRPKRRR KGLERCSGDV CRQENETVCE NIENLDNGGE VRSLEWYKEN QDNVKEKKQR  780
RRRKSVAETS NNSTVTTDCS QVKVGVKKLT PRRKVSAVVP VENQDAPN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-274096403159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-274096403159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013613959.10.0PREDICTED: snRNA-activating protein complex subunit 4-like isoform X1
TrEMBLA0A0D2ZRC10.0A0A0D2ZRC1_BRAOL; Uncharacterized protein
STRINGBra022280.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65042744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.10.0myb domain protein 4r1